User talk:Hyad

From Uncyclopedia, the content-free encyclopedia.

Jump to: navigation, search

The grass is always greener on the other user page. --JWSchmidt 02:19, 6 Jul 2005 (UTC)

Okkkkaaayyyy. It looks like someone likes grass. -Hyad 02:57, 6 Jul 2005 (UTC)

Contents

[edit] Seen in Recent Changes

N ! Sexual relations; 04:35 . . Hyad (Talk) (created paige) <-- caught my eye --JWSchmidt 05:10, 7 Jul 2005 (UTC)

lol, I figured saying "created page" every time I make a new page is a little boring. I didn't think anyone would right a response that quickly though. 8^) -Hyad 23:48, 7 Jul 2005 (UTC)
This UncyclopediA does not have enough hyads. Here is one more: The HyaD protein:
MSEQRVVVMGLGNLLWADEGFGVRVAERLYAHYHWPEYVEIVDGGTQGLNLLGYVESASHLLILDA

IDYGLEPGTLRTYAGERIPAYLSAKKMSLHQNSFSEVLALADIRGHLPAHIALVGLQPAMLDDYGGSLSELAREQLPAAEQAA

LAQLAAWGIVPQPANESRCLNYDCLSMENYEGVRLRQYRMTQEEQG (DECODE)
rothfl, JW. I hope you like yours. :p -Hyad 03:21, 8 Jul 2005 (UTC)

[edit] Yo!

Glad you like my Crazy Frog GIMPette. And I think we should keep most of the templates in the Template namespace (for sake of simplicity), in line with Wikipedia (Template:Subliminal is based on the original Wikipedia spoiler warning). Ettlz 09:18, 8 Jul 2005 (UTC)

Yeah, I thought we should keep the word Template: instead of FakeTemplate:. I just wrote that on my main user page in case people took offense to my going to their user pages and "stealing" their fake templates and making them real templates. I see you use the GIMP from Pulp Fiction, I use the old version: see below. -Hyad 05:50, 9 Jul 2005 (UTC)
Old version of GIMP running in xterm
Old version of GIMP running in xterm
Talking of that, I'm also into LaTeX, if you must know. Ettlz 21:19, 9 Jul 2005 (UTC)
Hyad, about that image you linked to on the Crazy Frog article. My mother almost caught me inspecting it. Lucikly, I use Firefox and had "Best of Goatse" on the other tab, and so much embarrassment was thus avoided.

[edit] Too Short

"I put the Template:Shortest page candidate (new version here) on the You have two cows page." Only 110450 bytes; slackers!

[edit] Double U or Wookie?

Well, if you think about it, he does sound like a wookie.And the "Double U" thing is pretty played out --Nytrospawn 13:37, 20 Jul 2005 (UTC)

[edit] If I told you, I'd have to kill you

So you know, Elvis and I are trying to keep the OW: page quiet until OW's birthday, when we plan to subtitute it for the main page. I hope you don't mind that I killed your link on OW's main page. While it's quite possible to sumble upon it, we'd like it to be somewhat surprizing to people. --Famine 13:42, 28 Jul 2005 (UTC)

The Wikipedia:Oscar Wilde page says his birthday is October 16. You're willing to wait that long? -Hyad 02:09, 29 Jul 2005 (UTC)
I've got elephant genes so we should be OK.--Elvis 12:54, 29 Jul 2005 (UTC)

[edit] Adding wikipedia to userpage links in Life and Death of a Template

It gets even geekier if you look carefully the signatures of the users that are also here actual link to there user page her (although perversly not yours as I didn't know you were the original author at the time).--Elvis 13:00, 29 Jul 2005 (UTC)

P.S. Someone has recreated it.

[edit] Wikipedia

Why the heck did you mark Wikipedia as {{stupid}}? - Guest 08:23, 18 Aug 2005 (UTC)

The same reason, Encyclopædia Dramatica has it's Wikipedia page to be voted for deletion. Rather than copy the idea, I'd figure I'd give it a "stupid warning" so people will not to use the it's fictional information. Wikipedia is "dangerous parody of Uncyclopedia" - [insert the name of Oscar Wilde here]. If you find it to be unfunny - you are free to remove it to "conform to an understandable standard of humor". -Hyad 20:56, 21 Aug 2005 (UTC)

[edit] Disneyland related fun!

Hyad. I see that you have become interested in the Disneyland articles. Edit your User talk page. I have something to tell you. --KP CUN 09:02, 23 Aug 2005 (UTC)

OK, very clever making it commented out. I use Template:Subliminal when I want to write something hidden. Or perhaps something like Template:Confused - try reading that. But I don't notice an anomaly. World domination - yup, that seems alright. Maybe I'm not looking hard enough. Is it like one of those Magic Eye deals? - I could never get those to work. 8^) -Hyad 09:15, 23 Aug 2005 (UTC)

Okay a found it based on what you didn't write. Wink, Wink. I originally thought it was in Disney Empire because you fake linked it there (in comments) . But it's not. All I can say is "very confusing." I'm sure that given time, every will all make sense. It better! -Hyad 04:58, 25 Aug 2005 (UTC)

Personal tools
projects