User talk:JWSchmidt

From Uncyclopedia, the content-free encyclopedia.

Jump to: navigation, search

Do you think there should be more pokemon-states besides Pikachusetts and Pichutah? -Hyad 04:15, 6 Jul 2005 (UTC)

Charizard --> Charazona --JWSchmidt 05:14, 6 Jul 2005 (UTC)

[edit] Vegitatians

Why did you change vegitarians from a redirect to an article? [1] We try not to have duplicates of the same subject. And we try to keep content original. Paulgb 04:10, 18 Dec 2005 (UTC)

[edit] WTF

This UncyclopediA does not have enough hyads. Here is one more: The HyaD protein:
MSEQRVVVMGLGNLLWADEGFGVRVAERLYAHYHWPEYVEIVDGGTQGLNLLGYVESASHLLILDA

IDYGLEPGTLRTYAGERIPAYLSAKKMSLHQNSFSEVLALADIRGHLPAHIALVGLQPAMLDDYGGSLSELAREQLPAAEQAA

LAQLAAWGIVPQPANESRCLNYDCLSMENYEGVRLRQYRMTQEEQG (DECODE)
WTF is this template, JWSchmidt? I don't know. Anyway, look at Darth Vader.

WhY ExactlY DO YoU CapitalizE ThE FirsT AnD LasT LetterS OF SomE WordS ON ThE HyaD TemplatE? -Hyad 03:19, 8 Jul 2005 (UTC)

I'D CapitalizE TheM AlL IfF i KneW HoW TO DO SmalL CapS LikE ThiS. --JWSchmidt 03:28, 8 Jul 2005 (UTC)

Ok, I understand completely, just like math. Is this image what you are thinking of as well as this? -Hyad 03:48, 8 Jul 2005 (UTC)

[edit] Man boobs

What are you doing to my man boobs? Should I call a policeman? --Marcos_Malo OUN S7fc BOotS Bur. | Talk 01:38, 28 Aug 2005 (UTC)

I wouldn't touch them with a double redirect. --JWSchmidt 01:42, 28 Aug 2005 (UTC)
Personal tools
projects